Lineage for d1hnzg_ (1hnz G:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4927Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
  4. 4928Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 4929Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 4930Protein Ribosomal protein S7 [47975] (2 species)
  7. 4933Species Thermus thermophilus [TaxId:274] [47977] (7 PDB entries)
  8. 4937Domain d1hnzg_: 1hnz G: [18396]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnzg_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1hnzg_:

Click to download the PDB-style file with coordinates for d1hnzg_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzg_: