![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
![]() | Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
![]() | Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
![]() | Protein Ribosomal protein S7 [47975] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47977] (15 PDB entries) |
![]() | Domain d1hr0g_: 1hr0 G: [18395] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOP Domain Sequences for d1hr0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus} arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d1hr0g_: