Lineage for d3pryb1 (3pry B:284-543)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157938Family d.14.1.8: Hsp90 middle domain [102755] (2 protein domains)
    related to the DNA gyrase/MutL family; contains extra C-terminal alpha/beta subdomain
    automatically mapped to Pfam PF00183
  6. 2157948Protein automated matches [191211] (1 species)
    not a true protein
  7. 2157949Species Human (Homo sapiens) [TaxId:9606] [189574] (1 PDB entry)
  8. 2157951Domain d3pryb1: 3pry B:284-543 [183947]
    Other proteins in same PDB: d3prya2, d3pryb2, d3pryc2
    automated match to d1usvc_
    complexed with edo, gol, so4

Details for d3pryb1

PDB Entry: 3pry (more details), 2.28 Å

PDB Description: Crystal structure of the middle domain of human HSP90-beta refined at 2.3 A resolution
PDB Compounds: (B:) heat shock protein hsp 90-beta

SCOPe Domain Sequences for d3pryb1:

Sequence, based on SEQRES records: (download)

>d3pryb1 d.14.1.8 (B:284-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktkpiwtrnpdditqeeygefyksltndwedhlavkhfsvegqlefrallfiprrapfdl
fenkkkknniklyvrrvfimdscdelipeylnfirgvvdsedlplnisremlqqskilkv
irknivkkclelfselaedkenykkfyeafsknlklgihedstnrrrlsellryhtsqsg
demtslseyvsrmketqksiyyitgeskeqvansafvervrkrgfevvymtepideycvq
qlkefdgkslvsvtkeglel

Sequence, based on observed residues (ATOM records): (download)

>d3pryb1 d.14.1.8 (B:284-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktkpiwtrnpdditqeeygefyksltndwedhlavkhfsvegqlefrallfiprrapnni
klyvrrvfimdscdelipeylnfirgvvdsedlplnemlqqskilkvirknivkkclelf
selaedkenykkfyeafsknlklgihedstnrrrlsellryhtsqsgdemtslseyvsrm
ketqksiyyitgeskeqvansafvervrkrgfevvymtepideycvqqlkefdgkslvsv
tkeglel

SCOPe Domain Coordinates for d3pryb1:

Click to download the PDB-style file with coordinates for d3pryb1.
(The format of our PDB-style files is described here.)

Timeline for d3pryb1: