Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (3 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [189957] (1 PDB entry) |
Domain d3prvd_: 3prv D: [183943] automated match to d1be4a_ |
PDB Entry: 3prv (more details), 2.69 Å
SCOPe Domain Sequences for d3prvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3prvd_ d.58.6.0 (D:) automated matches {Trypanosoma cruzi [TaxId: 5693]} tsertfiavkpdgvqrclvgeiiqrfekkgyklvalkmlqpsaeqaqqhyidlaskpfyk dlvayfssgpivgmvwegkgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsds vdsakreiafwfkpeelvnwtshsvkqvye
Timeline for d3prvd_: