Lineage for d1fjgg_ (1fjg G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740240Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1740241Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1740242Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1740243Protein Ribosomal protein S7 [47975] (4 species)
  7. 1740273Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1740280Domain d1fjgg_: 1fjg G: [18394]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgg_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1fjgg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d1fjgg_:

Click to download the PDB-style file with coordinates for d1fjgg_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgg_: