SCOPe 2.04: Domain d3prab_: 3pra B:

Lineage for d3prab_ (3pra B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (20 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [189612] (2 PDB entries)

8. Domain d3prab_: 3pra B: [183933]
   automated match to d1ix5a_

Details for d3prab_

PDB Entry: 3pra, 2.4 Å

PDB Description: structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26

PDB Compounds: (B:) FKBP-type peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3prab_:

Sequence; same for both SEQRES and ATOM records:

>d3prab_ d.26.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mvekgkmvkisydgyvdgklfdttneelakkegiynpamiygpvaifagegqvlpgldea
ilemdvgeerevvlppekafgkrdpskikliplseftkrgikpikgltitidgipgkivs
insgrvlvdfnhelagkevkyrikieevvd

Timeline for d3prab_:

• d3prab_ first appeared in SCOPe 2.01
  
• d3prab_ appears in SCOPe 2.03
  
• d3prab_ appears in SCOPe 2.05
  
• d3prab_ appears in the current release, SCOPe 2.08