Lineage for d3prab_ (3pra B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408627Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1408628Protein automated matches [191162] (11 species)
    not a true protein
  7. 1408655Species Methanocaldococcus jannaschii [TaxId:2190] [189612] (2 PDB entries)
  8. 1408658Domain d3prab_: 3pra B: [183933]
    automated match to d1ix5a_

Details for d3prab_

PDB Entry: 3pra (more details), 2.4 Å

PDB Description: structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
PDB Compounds: (B:) FKBP-type peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3prab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prab_ d.26.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mvekgkmvkisydgyvdgklfdttneelakkegiynpamiygpvaifagegqvlpgldea
ilemdvgeerevvlppekafgkrdpskikliplseftkrgikpikgltitidgipgkivs
insgrvlvdfnhelagkevkyrikieevvd

SCOPe Domain Coordinates for d3prab_:

Click to download the PDB-style file with coordinates for d3prab_.
(The format of our PDB-style files is described here.)

Timeline for d3prab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3praa_