Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (3 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:2190] [189612] (2 PDB entries) |
Domain d3prab_: 3pra B: [183933] automated match to d1ix5a_ |
PDB Entry: 3pra (more details), 2.4 Å
SCOPe Domain Sequences for d3prab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3prab_ d.26.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} mvekgkmvkisydgyvdgklfdttneelakkegiynpamiygpvaifagegqvlpgldea ilemdvgeerevvlppekafgkrdpskikliplseftkrgikpikgltitidgipgkivs insgrvlvdfnhelagkevkyrikieevvd
Timeline for d3prab_: