SCOPe 2.01: Domain d3pr9a_: 3pr9 A:

Lineage for d3pr9a_ (3pr9 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (3 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [189612] (2 PDB entries)

8. Domain d3pr9a_: 3pr9 A: [183931]
   automated match to d1ix5a_

Details for d3pr9a_

PDB Entry: 3pr9, 1.95 Å

PDB Description: structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26

PDB Compounds: (A:) FKBP-type peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3pr9a_:

Sequence; same for both SEQRES and ATOM records:

>d3pr9a_ d.26.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mvekgkmvkisydgyvdgklfdttneelakkegiynpamiygpvaifagegqvlpgldea
ilemdvgeerevvlppekafgkrdpskikliplseftkrgikpikgltitidgipgkivs
insgrvlvdfnhelagkevkyrikieevvd

Timeline for d3pr9a_:

• d3pr9a_ is new in SCOPe 2.01-stable
  
• d3pr9a_ appears in SCOPe 2.02
  
• d3pr9a_ appears in the current release, SCOPe 2.08