Lineage for d3pr1a_ (3pr1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873005Species Thermotoga maritima [TaxId:2336] [188476] (8 PDB entries)
  8. 2873010Domain d3pr1a_: 3pr1 A: [183928]
    automated match to d1sula_
    complexed with po4

Details for d3pr1a_

PDB Entry: 3pr1 (more details), 2.3 Å

PDB Description: Crystal structure of apo Thermotoga maritima ribosome biogenesis GTP-binding protein EngB
PDB Compounds: (A:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d3pr1a_:

Sequence, based on SEQRES records: (download)

>d3pr1a_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
iirdvelvkvartpgdyppplkgevafvgrsnvgkssllnalfnrkiafvsktpgktrsi
nfylvnskyyfvdlpgygyakvskkermlwkrlvedyfknrwslqmvfllvdgrippqds
dlmmvewmkslnipftivltkmdkvkmserakkleehrkvfskygeytiiptssvtgegi
selldlistllk

Sequence, based on observed residues (ATOM records): (download)

>d3pr1a_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
iirdvelvkvartpgdyppplkgevafvgrsnvgkssllnalfnrsinfylvnskyyfvd
lpgykermlwkrlvedyfknrwslqmvfllvdgrippqdsdlmmvewmkslnipftivlt
kmdkvkmserakkleehrkvfskygeytiiptssvtgegiselldlistllk

SCOPe Domain Coordinates for d3pr1a_:

Click to download the PDB-style file with coordinates for d3pr1a_.
(The format of our PDB-style files is described here.)

Timeline for d3pr1a_: