Lineage for d1rss__ (1rss -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445404Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 445405Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 445406Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 445407Protein Ribosomal protein S7 [47975] (3 species)
  7. 445412Species Thermus thermophilus [TaxId:274] [47977] (15 PDB entries)
  8. 445413Domain d1rss__: 1rss - [18392]

Details for d1rss__

PDB Entry: 1rss (more details), 1.9 Å

PDB Description: ribosomal protein s7 from thermus thermophilus

SCOP Domain Sequences for d1rss__:

Sequence, based on SEQRES records: (download)

>d1rss__ a.75.1.1 (-) Ribosomal protein S7 {Thermus thermophilus}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermaeanrayahyrw

Sequence, based on observed residues (ATOM records): (download)

>d1rss__ a.75.1.1 (-) Ribosomal protein S7 {Thermus thermophilus}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermaeahyrw

SCOP Domain Coordinates for d1rss__:

Click to download the PDB-style file with coordinates for d1rss__.
(The format of our PDB-style files is described here.)

Timeline for d1rss__: