Lineage for d1rssa_ (1rss A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718736Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 2718737Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 2718738Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 2718739Protein Ribosomal protein S7 [47975] (4 species)
  7. 2718769Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 2718770Domain d1rssa_: 1rss A: [18392]

Details for d1rssa_

PDB Entry: 1rss (more details), 1.9 Å

PDB Description: ribosomal protein s7 from thermus thermophilus
PDB Compounds: (A:) ribosomal protein s7

SCOPe Domain Sequences for d1rssa_:

Sequence, based on SEQRES records: (download)

>d1rssa_ a.75.1.1 (A:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermaeanrayahyrw

Sequence, based on observed residues (ATOM records): (download)

>d1rssa_ a.75.1.1 (A:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermaeahyrw

SCOPe Domain Coordinates for d1rssa_:

Click to download the PDB-style file with coordinates for d1rssa_.
(The format of our PDB-style files is described here.)

Timeline for d1rssa_: