Lineage for d3poka_ (3pok A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053109Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2053419Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 protein domains)
  6. 2053447Protein Interleukin-1beta [50363] (2 species)
  7. 2053448Species Human (Homo sapiens) [TaxId:9606] [50364] (26 PDB entries)
    Uniprot P01584 117-269
  8. 2053451Domain d3poka_: 3pok A: [183911]
    automated match to d1ioba_
    mutant

Details for d3poka_

PDB Entry: 3pok (more details), 1.7 Å

PDB Description: interleukin-1-beta lbt l3 mutant
PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d3poka_:

Sequence, based on SEQRES records: (download)

>d3poka_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlgyidtnndgwiegdelyptlqlesvdpknypkkkmekrfvfnkiein
nklefesaqfpnwyistsqaenmpvflggtkggqditdftmqfvss

Sequence, based on observed residues (ATOM records): (download)

>d3poka_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlgyidtndelyptlqlesvdpknypkkkmekrfvfnkieinnklefes
aqfpnwyistsqaenmpvflggtkggqditdftmqfvss

SCOPe Domain Coordinates for d3poka_:

Click to download the PDB-style file with coordinates for d3poka_.
(The format of our PDB-style files is described here.)

Timeline for d3poka_: