SCOPe 2.08: Domain d3poaa1: 3poa A:4-97

Lineage for d3poaa1 (3poa A:4-97)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.0: automated matches [191616] (1 protein)
   not a true family

6. Protein automated matches [191125] (8 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189619] (3 PDB entries)

8. Domain d3poaa1: 3poa A:4-97 [183910]
   Other proteins in same PDB: d3poaa2
   automated match to d2affa1
   complexed with zn

Details for d3poaa1

PDB Entry: 3poa, 2.01 Å

PDB Description: Structural and functional analysis of phosphothreonine-dependent FHA domain interactions

PDB Compounds: (A:) Putative uncharacterized protein TB39.8

SCOPe Domain Sequences for d3poaa1:

Sequence; same for both SEQRES and ATOM records:

>d3poaa1 b.26.1.0 (A:4-97) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvalladlns
tngttvnnapvqewqladgdvirlghseiivrmh

Timeline for d3poaa1:

• d3poaa1 first appeared in SCOPe 2.01, called d3poaa_
  
• d3poaa1 appears in SCOPe 2.07