Class a: All alpha proteins [46456] (289 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [47976] (1 PDB entry) |
Domain d1husa_: 1hus A: [18391] |
PDB Entry: 1hus (more details), 2.5 Å
SCOPe Domain Sequences for d1husa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1husa_ a.75.1.1 (A:) Ribosomal protein S7 {Bacillus stearothermophilus [TaxId: 1422]} rdvlpdpiynsklvtrlinkimidgkkskaqkilytafdiirertgkdpmevfeqalknv mpvlevrarrvgganyqvpvevrpdrrvslglrwlvqyarlrnektmeerlaneimdaan ntgaavkkredthkmaean
Timeline for d1husa_: