SCOPe 2.01: Domain d1husa_: 1hus A:

Lineage for d1husa_ (1hus A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47976] (1 PDB entry)

8. Domain d1husa_: 1hus A: [18391]

Details for d1husa_

PDB Entry: 1hus, 2.5 Å

PDB Description: ribosomal protein s7

PDB Compounds: (A:) ribosomal protein s7

SCOPe Domain Sequences for d1husa_:

Sequence; same for both SEQRES and ATOM records:

>d1husa_ a.75.1.1 (A:) Ribosomal protein S7 {Bacillus stearothermophilus [TaxId: 1422]}
rdvlpdpiynsklvtrlinkimidgkkskaqkilytafdiirertgkdpmevfeqalknv
mpvlevrarrvgganyqvpvevrpdrrvslglrwlvqyarlrnektmeerlaneimdaan
ntgaavkkredthkmaean

Timeline for d1husa_:

• d1husa_ first appeared (with stable ids) in SCOP 1.55, called d1hus__
  
• d1husa_ appears in SCOP 1.75
  
• d1husa_ appears in SCOPe 2.02
  
• d1husa_ appears in the current release, SCOPe 2.08