SCOP 1.71: Domain d1hus__: 1hus -

Lineage for d1hus__ (1hus -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47976] (1 PDB entry)

8. Domain d1hus__: 1hus - [18391]

Details for d1hus__

PDB Entry: 1hus, 2.5 Å

PDB Description: ribosomal protein s7

SCOP Domain Sequences for d1hus__:

Sequence; same for both SEQRES and ATOM records:

>d1hus__ a.75.1.1 (-) Ribosomal protein S7 {Bacillus stearothermophilus}
rdvlpdpiynsklvtrlinkimidgkkskaqkilytafdiirertgkdpmevfeqalknv
mpvlevrarrvgganyqvpvevrpdrrvslglrwlvqyarlrnektmeerlaneimdaan
ntgaavkkredthkmaean

Timeline for d1hus__:

• d1hus__ first appeared (with stable ids) in SCOP 1.55
  
• d1hus__ appears in SCOP 1.69
  
• d1hus__ is called d1husa_ in SCOP 1.73
  
• d1hus__ appears in the current release, SCOPe 2.08, called d1husa_