Lineage for d1hus__ (1hus -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) 
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) Protein Ribosomal protein S7 [47975] (2 species) 
Species Bacillus stearothermophilus [TaxId:1422] [47976] (1 PDB entry) 
Domain d1hus__: 1hus - [18391]
Details for d1hus__
PDB Entry: 1hus (more details), 2.5 Å
PDB Description: ribosomal protein s7
SCOP Domain Sequences for d1hus__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hus__ a.75.1.1 (-) Ribosomal protein S7 {Bacillus stearothermophilus}
rdvlpdpiynsklvtrlinkimidgkkskaqkilytafdiirertgkdpmevfeqalknv
mpvlevrarrvgganyqvpvevrpdrrvslglrwlvqyarlrnektmeerlaneimdaan
ntgaavkkredthkmaean
SCOP Domain Coordinates for d1hus__:
Click to download the PDB-style file with coordinates for d1hus__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hus__:
- d1hus__ appears in SCOP 1.57
- d1hus__ appears in the current release, SCOPe 2.08, called d1husa_
View in 3D