Lineage for d1hus__ (1hus -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4927Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
  4. 4928Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 4929Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 4930Protein Ribosomal protein S7 [47975] (2 species)
  7. 4931Species Bacillus stearothermophilus [TaxId:1422] [47976] (1 PDB entry)
  8. 4932Domain d1hus__: 1hus - [18391]

Details for d1hus__

PDB Entry: 1hus (more details), 2.5 Å

PDB Description: ribosomal protein s7

SCOP Domain Sequences for d1hus__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hus__ a.75.1.1 (-) Ribosomal protein S7 {Bacillus stearothermophilus}
rdvlpdpiynsklvtrlinkimidgkkskaqkilytafdiirertgkdpmevfeqalknv
mpvlevrarrvgganyqvpvevrpdrrvslglrwlvqyarlrnektmeerlaneimdaan
ntgaavkkredthkmaean

SCOP Domain Coordinates for d1hus__:

Click to download the PDB-style file with coordinates for d1hus__.
(The format of our PDB-style files is described here.)

Timeline for d1hus__: