Lineage for d3po8a1 (3po8 A:3-97)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049541Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2049542Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2049677Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2049678Protein automated matches [191125] (7 species)
    not a true protein
  7. 2049697Species Mycobacterium tuberculosis [TaxId:1773] [189619] (3 PDB entries)
  8. 2049698Domain d3po8a1: 3po8 A:3-97 [183907]
    Other proteins in same PDB: d3po8a2
    automated match to d2affa1
    complexed with po4

Details for d3po8a1

PDB Entry: 3po8 (more details), 1.5 Å

PDB Description: Structural and functional analysis of phosphothreonine-dependent FHA domain interactions
PDB Compounds: (A:) Putative uncharacterized protein TB39.8

SCOPe Domain Sequences for d3po8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3po8a1 b.26.1.0 (A:3-97) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvalladln
stngttvnnapvqewqladgdvirlghseiivrmh

SCOPe Domain Coordinates for d3po8a1:

Click to download the PDB-style file with coordinates for d3po8a1.
(The format of our PDB-style files is described here.)

Timeline for d3po8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3po8a2