Lineage for d3po8a_ (3po8 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779760Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1779761Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1779881Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 1779882Protein automated matches [191125] (7 species)
    not a true protein
  7. 1779901Species Mycobacterium tuberculosis [TaxId:1773] [189619] (3 PDB entries)
  8. 1779902Domain d3po8a_: 3po8 A: [183907]
    automated match to d2affa1
    complexed with po4

Details for d3po8a_

PDB Entry: 3po8 (more details), 1.5 Å

PDB Description: Structural and functional analysis of phosphothreonine-dependent FHA domain interactions
PDB Compounds: (A:) Putative uncharacterized protein TB39.8

SCOPe Domain Sequences for d3po8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3po8a_ b.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvalladln
stngttvnnapvqewqladgdvirlghseiivrmhplt

SCOPe Domain Coordinates for d3po8a_:

Click to download the PDB-style file with coordinates for d3po8a_.
(The format of our PDB-style files is described here.)

Timeline for d3po8a_: