Lineage for d1ad6__ (1ad6 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily) Superfamily a.74.1: Cyclin-like [47954] (3 families) 
Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein) Protein Retinoblastoma tumor suppressor domains [47970] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47971] (2 PDB entries) 
Domain d1ad6__: 1ad6 - [18390]
Details for d1ad6__
PDB Entry: 1ad6 (more details), 2.3 Å
PDB Description: domain a of human retinoblastoma tumor suppressor
SCOP Domain Sequences for d1ad6__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad6__ a.74.1.3 (-) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
vmntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqg
cveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmat
ysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehri
mesla
SCOP Domain Coordinates for d1ad6__:
Click to download the PDB-style file with coordinates for d1ad6__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ad6__:
- d1ad6__ appears in SCOP 1.57
- d1ad6__ appears in the current release, SCOPe 2.08, called d1ad6a_
View in 3D