Lineage for d3pnsl_ (3pns L:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 997377Protein automated matches [190142] (12 species)
    not a true protein
  7. 997434Species Vibrio cholerae [TaxId:243277] [189490] (2 PDB entries)
  8. 997448Domain d3pnsl_: 3pns L: [183899]
    automated match to d1k3fa_
    complexed with acy, cl, fmt, gol, so4, ura

Details for d3pnsl_

PDB Entry: 3pns (more details), 2 Å

PDB Description: Crystal Structure of Uridine Phosphorylase Complexed with Uracil from Vibrio cholerae O1 biovar El Tor
PDB Compounds: (L:) Uridine phosphorylase

SCOPe Domain Sequences for d3pnsl_:

Sequence, based on SEQRES records: (download)

>d3pnsl_ c.56.2.1 (L:) automated matches {Vibrio cholerae [TaxId: 243277]}
tvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvvv
cstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhfa
pmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgsm
kewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsikv
vveaarkml

Sequence, based on observed residues (ATOM records): (download)

>d3pnsl_ c.56.2.1 (L:) automated matches {Vibrio cholerae [TaxId: 243277]}
tvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvvv
cstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhfa
pmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgsm
kewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeatlketearsikvvvea
arkml

SCOPe Domain Coordinates for d3pnsl_:

Click to download the PDB-style file with coordinates for d3pnsl_.
(The format of our PDB-style files is described here.)

Timeline for d3pnsl_: