Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (21 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [189490] (2 PDB entries) |
Domain d3pnsk_: 3pns K: [183898] automated match to d1k3fa_ complexed with acy, cl, fmt, gol, so4, ura |
PDB Entry: 3pns (more details), 2 Å
SCOPe Domain Sequences for d3pnsk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pnsk_ c.56.2.1 (K:) automated matches {Vibrio cholerae [TaxId: 243277]} tktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsv vvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslh fapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqg smkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsi kvvveaarkml
Timeline for d3pnsk_: