Lineage for d1guxb_ (1gux B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540337Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 540338Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 540513Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 540514Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 540515Species Human (Homo sapiens) [TaxId:9606] [47971] (5 PDB entries)
  8. 540517Domain d1guxb_: 1gux B: [18389]
    domains A and B

Details for d1guxb_

PDB Entry: 1gux (more details), 1.85 Å

PDB Description: rb pocket bound to e7 lxcxe motif

SCOP Domain Sequences for d1guxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guxb_ a.74.1.3 (B:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
tslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqim
mcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqrl
ktnilqyastrpptlspiphi

SCOP Domain Coordinates for d1guxb_:

Click to download the PDB-style file with coordinates for d1guxb_.
(The format of our PDB-style files is described here.)

Timeline for d1guxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1guxa_