![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
![]() | Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) ![]() domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
![]() | Family c.119.1.2: DAK1 [109613] (3 proteins) Pfam PF02733 |
![]() | Protein automated matches [191219] (1 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189602] (6 PDB entries) |
![]() | Domain d3pnmc_: 3pnm C: [183878] automated match to d1oi2a_ |
PDB Entry: 3pnm (more details), 2.55 Å
SCOPe Domain Sequences for d3pnmc_:
Sequence, based on SEQRES records: (download)
>d3pnmc_ c.119.1.2 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsgaepmhcgyigqgml sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi algactvpaagkpsftladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyh rtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagl tiernligayctsldmtgfsitllkvddetlalwdapvhtpalnwgk
>d3pnmc_ c.119.1.2 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsgaepmhcgyigqgml sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi algasftladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyhrtlrfwdyq qgswqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernliga yctsldmtgfsitllkvddetlalwdapvhtpalnwgk
Timeline for d3pnmc_: