SCOPe 2.01: Domain d3pnlb_: 3pnl B:

Lineage for d3pnlb_ (3pnl B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.208: DhaL-like [101472] (1 superfamily)
   multihelical; bundle

4. Superfamily a.208.1: DhaL-like [101473] (2 families)

5. Family a.208.1.0: automated matches [191401] (1 protein)
   not a true family

6. Protein automated matches [190529] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189603] (1 PDB entry)

8. Domain d3pnlb_: 3pnl B: [183875]
   Other proteins in same PDB: d3pnla_
   automated match to d3cr3a1
   complexed with adp, gol, mg

Details for d3pnlb_

PDB Entry: 3pnl, 2.2 Å

PDB Description: crystal structure of e.coli dha kinase dhak-dhal complex

PDB Compounds: (B:) PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL

SCOPe Domain Sequences for d3pnlb_:

Sequence; same for both SEQRES and ATOM records:

>d3pnlb_ a.208.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gsslsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadk
digfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvis
rgkaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgra
sylgersighqdpgatsvmfmmqmlalaake

Timeline for d3pnlb_:

• d3pnlb_ is new in SCOPe 2.01-stable
  
• d3pnlb_ appears in SCOPe 2.02
  
• d3pnlb_ appears in the current release, SCOPe 2.08, called d3pnlb1