Lineage for d3pnlb1 (3pnl B:2-210)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736564Fold a.208: DhaL-like [101472] (1 superfamily)
    multihelical; bundle
  4. 2736565Superfamily a.208.1: DhaL-like [101473] (2 families) (S)
  5. 2736577Family a.208.1.0: automated matches [191401] (1 protein)
    not a true family
  6. 2736578Protein automated matches [190529] (2 species)
    not a true protein
  7. 2736579Species Escherichia coli K-12 [TaxId:83333] [189603] (2 PDB entries)
  8. 2736580Domain d3pnlb1: 3pnl B:2-210 [183875]
    Other proteins in same PDB: d3pnla1, d3pnla2, d3pnlb2
    automated match to d3cr3a1
    complexed with adp, gol, mg

Details for d3pnlb1

PDB Entry: 3pnl (more details), 2.2 Å

PDB Description: crystal structure of e.coli dha kinase dhak-dhal complex
PDB Compounds: (B:) PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL

SCOPe Domain Sequences for d3pnlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pnlb1 a.208.1.0 (B:2-210) automated matches {Escherichia coli K-12 [TaxId: 83333]}
slsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadkdi
gfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvisrg
kaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgrasy
lgersighqdpgatsvmfmmqmlalaake

SCOPe Domain Coordinates for d3pnlb1:

Click to download the PDB-style file with coordinates for d3pnlb1.
(The format of our PDB-style files is described here.)

Timeline for d3pnlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pnlb2