Lineage for d3pnkb_ (3pnk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921751Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2921752Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2921763Family c.119.1.2: DAK1 [109613] (3 proteins)
    Pfam PF02733
  6. 2921780Protein automated matches [191219] (1 species)
    not a true protein
  7. 2921781Species Escherichia coli K-12 [TaxId:83333] [189602] (6 PDB entries)
  8. 2921787Domain d3pnkb_: 3pnk B: [183873]
    automated match to d1oi2a_
    complexed with gol

Details for d3pnkb_

PDB Entry: 3pnk (more details), 2.21 Å

PDB Description: crystal structure of e.coli dha kinase dhak
PDB Compounds: (B:) PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit dhaK

SCOPe Domain Sequences for d3pnkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pnkb_ c.119.1.2 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kklindvqdvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhc
gyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellh
dsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrkln
nqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfssldqtvdemfdt
llvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatplselygvynrlt
trcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtpalnwg

SCOPe Domain Coordinates for d3pnkb_:

Click to download the PDB-style file with coordinates for d3pnkb_.
(The format of our PDB-style files is described here.)

Timeline for d3pnkb_: