SCOPe 2.05: Domain d3pnka_: 3pnk A:

Lineage for d3pnka_ (3pnk A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.2: DAK1 [109613] (3 proteins)
   Pfam PF02733

6. Protein automated matches [191219] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189602] (6 PDB entries)

8. Domain d3pnka_: 3pnk A: [183872]
   automated match to d1oi2a_
   complexed with gol

Details for d3pnka_

PDB Entry: 3pnk, 2.21 Å

PDB Description: crystal structure of e.coli dha kinase dhak

PDB Compounds: (A:) PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit dhaK

SCOPe Domain Sequences for d3pnka_:

Sequence; same for both SEQRES and ATOM records:

>d3pnka_ c.119.1.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kklindvqdvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhc
gyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellh
dsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrkln
nqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfssldqtvdemfdt
llvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatplselygvynrlt
trcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtpalnwg

Timeline for d3pnka_:

• d3pnka_ first appeared in SCOPe 2.01
  
• d3pnka_ appears in SCOPe 2.04
  
• d3pnka_ appears in SCOPe 2.06
  
• d3pnka_ appears in the current release, SCOPe 2.08