![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) ![]() |
![]() | Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins) contains only one 4Fe-4S cluster |
![]() | Protein Fe3S4-ferredoxin PF1909 [110946] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [110947] (3 PDB entries) Uniprot P29603 |
![]() | Domain d3pnia_: 3pni A: [183870] automated match to d1siza_ complexed with co, f3s |
PDB Entry: 3pni (more details), 2.8 Å
SCOPe Domain Sequences for d3pnia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pnia_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} awkvsvdqdtcigcaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa itieea
Timeline for d3pnia_: