Lineage for d1d3ub1 (1d3u B:1100-1205)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49209Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 49210Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 49255Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)
  6. 49256Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)
  7. 49257Species Archaeon Pyrococcus woesei [TaxId:2262] [47968] (2 PDB entries)
  8. 49260Domain d1d3ub1: 1d3u B:1100-1205 [18386]
    Other proteins in same PDB: d1d3ua1, d1d3ua2

Details for d1d3ub1

PDB Entry: 1d3u (more details), 2.4 Å

PDB Description: tata-binding protein/transcription factor (ii)b/bre+tata-box complex from pyrococcus woesei

SCOP Domain Sequences for d1d3ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3ub1 a.74.1.2 (B:1100-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei}
mvsdaaernlafalseldritaqlklprhveeeaarlyreavrkglirgrsiesvmaacv
yaacrllkvprtldeiadiarvdkkeigrsyrfiarnlnltpkklf

SCOP Domain Coordinates for d1d3ub1:

Click to download the PDB-style file with coordinates for d1d3ub1.
(The format of our PDB-style files is described here.)

Timeline for d1d3ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d3ub2