Lineage for d3pn7c_ (3pn7 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711347Species Placopecten magellanicus [TaxId:6577] [189594] (3 PDB entries)
  8. 2711349Domain d3pn7c_: 3pn7 C: [183859]
    automated match to d1qviz_
    complexed with ca, mg

Details for d3pn7c_

PDB Entry: 3pn7 (more details), 2.25 Å

PDB Description: Visualizing new hinges and a potential major source of compliance in the lever arm of myosin
PDB Compounds: (C:) myosin essential light chain

SCOPe Domain Sequences for d3pn7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pn7c_ a.39.1.5 (C:) automated matches {Placopecten magellanicus [TaxId: 6577]}
klsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmgek
slpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsdee
vdeiinltdlqedlegnvkyeefvkkvmtgpy

SCOPe Domain Coordinates for d3pn7c_:

Click to download the PDB-style file with coordinates for d3pn7c_.
(The format of our PDB-style files is described here.)

Timeline for d3pn7c_: