![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein automated matches [190064] (21 species) not a true protein |
![]() | Species Placopecten magellanicus [TaxId:6577] [189594] (3 PDB entries) |
![]() | Domain d3pn7b_: 3pn7 B: [183858] automated match to d1kk7y_ complexed with ca, mg |
PDB Entry: 3pn7 (more details), 2.25 Å
SCOPe Domain Sequences for d3pn7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pn7b_ a.39.1.5 (B:) automated matches {Placopecten magellanicus [TaxId: 6577]} rlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapgplnft mflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdemrmtfk eapveggkfdyvrfvamikgs
Timeline for d3pn7b_: