![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein automated matches [190156] (4 species) not a true protein |
![]() | Species Cryphonectria parasitica [TaxId:5116] [187236] (21 PDB entries) |
![]() | Domain d3pmya_: 3pmy A: [183857] automated match to d1e5oe_ complexed with 41l, gol |
PDB Entry: 3pmy (more details), 1.38 Å
SCOPe Domain Sequences for d3pmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmya_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]} stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi ginifgdvalkaafvvfngattptlgfask
Timeline for d3pmya_: