Lineage for d3pmta_ (3pmt A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055135Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2055136Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 2055214Protein Tudor domain-containing protein 3, TDRD3 [141201] (2 species)
  7. 2055215Species Human (Homo sapiens) [TaxId:9606] [189550] (2 PDB entries)
  8. 2055217Domain d3pmta_: 3pmt A: [183852]
    automated match to d2d9ta1
    complexed with pg4

Details for d3pmta_

PDB Entry: 3pmt (more details), 1.8 Å

PDB Description: crystal structure of the tudor domain of human tudor domain-containing protein 3
PDB Compounds: (A:) Tudor domain-containing protein 3

SCOPe Domain Sequences for d3pmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmta_ b.34.9.1 (A:) Tudor domain-containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
kmwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi

SCOPe Domain Coordinates for d3pmta_:

Click to download the PDB-style file with coordinates for d3pmta_.
(The format of our PDB-style files is described here.)

Timeline for d3pmta_: