Lineage for d3pmrb_ (3pmr B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714459Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2714523Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) (S)
    the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)
  5. 2714537Family a.47.4.0: automated matches [191661] (1 protein)
    not a true family
  6. 2714538Protein automated matches [191241] (2 species)
    not a true protein
  7. 2714539Species Human (Homo sapiens) [TaxId:9606] [189704] (7 PDB entries)
  8. 2714541Domain d3pmrb_: 3pmr B: [183851]
    automated match to d1rw6a_
    complexed with po4

Details for d3pmrb_

PDB Entry: 3pmr (more details), 2.11 Å

PDB Description: Crystal Structure of E2 domain of Human Amyloid Precursor-Like Protein 1
PDB Compounds: (B:) Amyloid-like protein 1

SCOPe Domain Sequences for d3pmrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmrb_ a.47.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgvdiyfgmpgeisehegflrakmdleerrmrqinevmrewamadnqsknlpkadrqaln
ehfqsilqtleeqvsgerqrlvethatrvialindqrraalegflaalqadppqaervll
alrrylraeqkeqrhtlrhyqhvaavdpekaqqmrfqvhthlqvieervnqslglldqnp
hlaqelrpqiqellhseh

SCOPe Domain Coordinates for d3pmrb_:

Click to download the PDB-style file with coordinates for d3pmrb_.
(The format of our PDB-style files is described here.)

Timeline for d3pmrb_: