![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
![]() | Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) ![]() the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965) |
![]() | Family a.47.4.0: automated matches [191661] (1 protein) not a true family |
![]() | Protein automated matches [191241] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189704] (7 PDB entries) |
![]() | Domain d3pmrb_: 3pmr B: [183851] automated match to d1rw6a_ complexed with po4 |
PDB Entry: 3pmr (more details), 2.11 Å
SCOPe Domain Sequences for d3pmrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmrb_ a.47.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dgvdiyfgmpgeisehegflrakmdleerrmrqinevmrewamadnqsknlpkadrqaln ehfqsilqtleeqvsgerqrlvethatrvialindqrraalegflaalqadppqaervll alrrylraeqkeqrhtlrhyqhvaavdpekaqqmrfqvhthlqvieervnqslglldqnp hlaqelrpqiqellhseh
Timeline for d3pmrb_: