Lineage for d3pmfa_ (3pmf A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058099Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2058100Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2058373Protein automated matches [190761] (2 species)
    not a true protein
  7. 2058374Species Staphylococcus aureus [TaxId:1280] [188650] (41 PDB entries)
  8. 2058387Domain d3pmfa_: 3pmf A: [183846]
    automated match to d1joka_
    complexed with ca, thp

Details for d3pmfa_

PDB Entry: 3pmf (more details), 1.6 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs v23a at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d3pmfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmfa_ b.40.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtaklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws

SCOPe Domain Coordinates for d3pmfa_:

Click to download the PDB-style file with coordinates for d3pmfa_.
(The format of our PDB-style files is described here.)

Timeline for d3pmfa_: