Lineage for d3plyc_ (3ply C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1527469Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1527470Protein Amicyanin [49505] (2 species)
  7. 1527471Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 1527532Domain d3plyc_: 3ply C: [183840]
    automated match to d1aaca_
    complexed with cu, k, na, po4; mutant

Details for d3plyc_

PDB Entry: 3ply (more details), 2.2 Å

PDB Description: Structure of Oxidized P96G Mutant of Amicyanin
PDB Compounds: (C:) amicyanin

SCOPe Domain Sequences for d3plyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3plyc_ b.6.1.1 (C:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphgfmrgkvvve

SCOPe Domain Coordinates for d3plyc_:

Click to download the PDB-style file with coordinates for d3plyc_.
(The format of our PDB-style files is described here.)

Timeline for d3plyc_: