![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein) |
![]() | Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species) |
![]() | Species Pyrococcus woesei [TaxId:2262] [47968] (2 PDB entries) |
![]() | Domain d1aisb1: 1ais B:1108-1205 [18384] Other proteins in same PDB: d1aisa1, d1aisa2 protein/DNA complex |
PDB Entry: 1ais (more details), 2.1 Å
SCOPe Domain Sequences for d1aisb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Pyrococcus woesei [TaxId: 2262]} nlafalseldritaqlklprhveeeaarlyreavrkglirgrsiesvmaacvyaacrllk vprtldeiadiarvdkkeigrsyrfiarnlnltpkklf
Timeline for d1aisb1: