SCOPe 2.06: Domain d3plsa_: 3pls A:

Lineage for d3plsa_ (3pls A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)

8. Domain d3plsa_: 3pls A: [183837]
   automated match to d1r0pa_
   complexed with anp, mg

Details for d3plsa_

PDB Entry: 3pls, 2.24 Å

PDB Description: RON in complex with ligand AMP-PNP

PDB Compounds: (A:) Macrophage-stimulating protein receptor

SCOPe Domain Sequences for d3plsa_:

Sequence; same for both SEQRES and ATOM records:

>d3plsa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdldsallaevkdvliphervvthsdrvigkghfgvvyhgeyidqaqnriqcaikslsri
temqqveaflregllmrglnhpnvlaligimlppeglphvllpymchgdllqfirspqrn
ptvkdlisfglqvargmeylaeqkfvhrdlaarncmldesftvkvadfglardildreyy
svqqhrharlpvkwtaleslqtyrfttksdvwsfgvllwelltrgappyrhidpfdlthf
laqgrrlpqpeycpdslyqvmqqcweadpavrptfrvlvgeveqivsallgdhyvqlp

Timeline for d3plsa_:

• d3plsa_ first appeared in SCOPe 2.01
  
• d3plsa_ appears in SCOPe 2.05
  
• d3plsa_ appears in SCOPe 2.07
  
• d3plsa_ appears in the current release, SCOPe 2.08