SCOPe 2.01: Domain d3plla_: 3pll A:

Lineage for d3plla_ (3pll A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein automated matches [190156] (3 species)
   not a true protein

7. Species Cryphonectria parasitica [TaxId:5116] [187236] (21 PDB entries)

8. Domain d3plla_: 3pll A: [183835]
   automated match to d1e5oe_
   complexed with f06, gol

Details for d3plla_

PDB Entry: 3pll, 1.73 Å

PDB Description: Endothiapepsin in complex with a fragment

PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d3plla_:

Sequence; same for both SEQRES and ATOM records:

>d3plla_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

Timeline for d3plla_:

• d3plla_ is new in SCOPe 2.01-stable
  
• d3plla_ appears in SCOPe 2.02
  
• d3plla_ appears in the current release, SCOPe 2.08