SCOP 1.59: Domain d1tfb_2: 1tfb 208-316

Lineage for d1tfb_2 (1tfb 208-316)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)

5. Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)

6. Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47967] (3 PDB entries)

8. Domain d1tfb_2: 1tfb 208-316 [18383]

Details for d1tfb_2

PDB Entry: 1tfb

PDB Description: nmr studies of human general transcription factor tfiib: dynamics and interaction with vp16 activation domain, 20 structures

SCOP Domain Sequences for d1tfb_2:

Sequence; same for both SEQRES and ATOM records:

>d1tfb_2 a.74.1.2 (208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens)}
littgdfmsrfcsnlclpkqvqmaathiarkaveldlvpgrspisvaaaaiymasqasae
krtqkeigdiagvadvtirqsyrliyprapdlfptdfkfdtpvdklpql

Timeline for d1tfb_2:

• d1tfb_2 first appeared (with stable ids) in SCOP 1.55
  
• d1tfb_2 appears in SCOP 1.57
  
• d1tfb_2 appears in SCOP 1.61
  
• d1tfb_2 appears in the current release, SCOPe 2.08, called d1tfba2