SCOPe 2.08: Domain d3pl2c_: 3pl2 C:

Lineage for d3pl2c_ (3pl2 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [189540] (1 PDB entry)

8. Domain d3pl2c_: 3pl2 C: [183824]
   automated match to d1wyea1
   complexed with cit

Details for d3pl2c_

PDB Entry: 3pl2, 1.89 Å

PDB Description: crystal structure of a 5-keto-2-deoxygluconokinase (ncgl0155, cgl0158) from corynebacterium glutamicum atcc 13032 kitasato at 1.89 a resolution

PDB Compounds: (C:) Sugar kinase, ribokinase family

SCOPe Domain Sequences for d3pl2c_:

Sequence; same for both SEQRES and ATOM records:

>d3pl2c_ c.72.1.0 (C:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
sthevlaigrlgvdiyplqsgvgladvqsfgkylggsaanvsvaaarhghnsallsrvgn
dpfgeyllaelerlgvdnqyvatdqtfktpvtfceifppddfplyfyrepkapdlniesa
dvslddvreadilwftltgfseepsrgthreilttranrrhtifdldyrpmfwespeeat
kqaewalqhstvavgnkeeceiavgeteperagrallergvelaivkqgpkgvmamtkde
tvevppffvdvinglgagdafggalchgllsewplekvlrfantagalvasrlecstamp
ttdeveasln

Timeline for d3pl2c_:

• d3pl2c_ first appeared in SCOPe 2.01
  
• d3pl2c_ appears in SCOPe 2.07