| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) ![]() |
| Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
| Protein automated matches [190499] (26 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [189601] (2 PDB entries) |
| Domain d3pl1a_: 3pl1 A: [183821] automated match to d1ilwa_ complexed with fe2 |
PDB Entry: 3pl1 (more details), 2.2 Å
SCOPe Domain Sequences for d3pl1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pl1a_ c.33.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mraliivdvqndfceggslavtggaalaraisdylaeaadyhhvvatkdfhidpgdhfsg
tpdyssswpphcvsgtpgadfhpsldtsaieavfykgaytgaysgfegvdengtpllnwl
rqrgvdevdvvgiatdhcvrqtaedavrnglatrvlvdltagvsadttvaaleemrtasv
elvcs
Timeline for d3pl1a_: