Lineage for d3pkqb_ (3pkq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133255Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 protein domains)
    automatically mapped to Pfam PF00483
  6. 2133386Protein automated matches [191218] (4 species)
    not a true protein
  7. 2133428Species Salmonella typhimurium [TaxId:90371] [189600] (2 PDB entries)
  8. 2133430Domain d3pkqb_: 3pkq B: [183818]
    automated match to d1iima_
    complexed with dgt, mg, peg

Details for d3pkqb_

PDB Entry: 3pkq (more details), 2.4 Å

PDB Description: q83d variant of s. enterica rmla with dgtp
PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d3pkqb_:

Sequence, based on SEQRES records: (download)

>d3pkqb_ c.68.1.6 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mktrkgiilaggsgtrlypvtmavskqllpiydkpmiyyplstlmlagirdiliistpqd
tprfqqllgdgsqwglnlqykvdpspdglaqafiigeefighddcalvlgdnifyghdlp
klmeaavnkesgatvfayhvndperygvvefdqkgtavsleekplqpksnyavtglyfyd
nsvvemaknlkpsargeleitdinriymeqgrlsvammgrgyawldtgthqslieasnfi
atieerqglkvscpeeiafrknfinaqqvielagplskndygkyllkmvk

Sequence, based on observed residues (ATOM records): (download)

>d3pkqb_ c.68.1.6 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mktrkgiilaggsgtrlypvtmavskqllpiydkpmiyyplstlmlagirdiliistpqd
tprfqqllgdgsqwglnlqykvdpspdglaqafiigeefighddcalvlgdnifyghdlp
klmeaavnkesgatvfayhvndperygvvefdqkgtavsleekppkyavtglyfydnsvv
emaknlkpsargeleitdinriymeqgrlsvammgrgyawldtgthqslieasnfiatie
erqglkvscpeeiafrknfinaqqvielagplskndygkyllkmvk

SCOPe Domain Coordinates for d3pkqb_:

Click to download the PDB-style file with coordinates for d3pkqb_.
(The format of our PDB-style files is described here.)

Timeline for d3pkqb_: