Lineage for d3pk0d1 (3pk0 D:1-258)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847722Species Mycobacterium smegmatis [TaxId:246196] [189539] (12 PDB entries)
  8. 2847738Domain d3pk0d1: 3pk0 D:1-258 [183808]
    Other proteins in same PDB: d3pk0a2, d3pk0b2, d3pk0c2, d3pk0d2
    automated match to d2c07a1
    complexed with ca, cl, gol, peg

Details for d3pk0d1

PDB Entry: 3pk0 (more details), 1.75 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis
PDB Compounds: (D:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3pk0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pk0d1 c.2.1.0 (D:1-258) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mfdlqgrsvvvtggtkgigrgiatvfaraganvavagrstadidacvadldqlgsgkvig
vqtdvsdraqcdalagraveefggidvvcanagvfpdaplatmtpeqlngifavnvngtf
yavqacldaliasgsgrvvltssitgpitgypgwshygatkaaqlgfmrtaaielaphki
tvnaimpgnimtegllengeeyiasmarsipagalgtpedighlaaflatkeagyitgqa
iavdggqvlpesldaiat

SCOPe Domain Coordinates for d3pk0d1:

Click to download the PDB-style file with coordinates for d3pk0d1.
(The format of our PDB-style files is described here.)

Timeline for d3pk0d1: