SCOPe 2.01: Domain d3pk0c_: 3pk0 C:

Lineage for d3pk0c_ (3pk0 C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (51 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [189539] (2 PDB entries)

8. Domain d3pk0c_: 3pk0 C: [183807]
   automated match to d2c07a1
   complexed with ca, cl, gol, peg

Details for d3pk0c_

PDB Entry: 3pk0, 1.75 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis

PDB Compounds: (C:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3pk0c_:

Sequence; same for both SEQRES and ATOM records:

>d3pk0c_ c.2.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
gpgsmfdlqgrsvvvtggtkgigrgiatvfaraganvavagrstadidacvadldqlgsg
kvigvqtdvsdraqcdalagraveefggidvvcanagvfpdaplatmtpeqlngifavnv
ngtfyavqacldaliasgsgrvvltssitgpitgypgwshygatkaaqlgfmrtaaiela
phkitvnaimpgnimtegllengeeyiasmarsipagalgtpedighlaaflatkeagyi
tgqaiavdggqvlpesldaiat

Timeline for d3pk0c_:

• d3pk0c_ is new in SCOPe 2.01-stable
  
• d3pk0c_ appears in SCOPe 2.02
  
• d3pk0c_ appears in the current release, SCOPe 2.08, called d3pk0c1