Lineage for d3pjja_ (3pjj A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2420909Protein Carbonic anhydrase [51071] (10 species)
  7. 2420951Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (971 PDB entries)
    Uniprot P00918
  8. 2421594Domain d3pjja_: 3pjj A: [183804]
    automated match to d1cana_
    complexed with mzh, zn

Details for d3pjja_

PDB Entry: 3pjj (more details), 1.8 Å

PDB Description: synthetic dimer of human carbonic anhydrase ii
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d3pjja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pjja_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgcavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllesvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d3pjja_:

Click to download the PDB-style file with coordinates for d3pjja_.
(The format of our PDB-style files is described here.)

Timeline for d3pjja_: