Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (10 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [189538] (1 PDB entry) |
Domain d3pj9c_: 3pj9 C: [183794] automated match to d1nhkr_ complexed with so4 |
PDB Entry: 3pj9 (more details), 2.1 Å
SCOPe Domain Sequences for d3pj9c_:
Sequence, based on SEQRES records: (download)
>d3pj9c_ d.58.6.1 (C:) automated matches {Campylobacter jejuni [TaxId: 192222]} mektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpffkd lvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgsdsl enakieiefffkpneic
>d3pj9c_ d.58.6.1 (C:) automated matches {Campylobacter jejuni [TaxId: 192222]} mektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkrpffkdl vefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgsdsle nakieiefffkpneic
Timeline for d3pj9c_: