Lineage for d3pj7a_ (3pj7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547260Protein automated matches [190406] (22 species)
    not a true protein
  7. 2547592Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (23 PDB entries)
  8. 2547618Domain d3pj7a_: 3pj7 A: [183787]
    automated match to d1uisa_

Details for d3pj7a_

PDB Entry: 3pj7 (more details), 1.85 Å

PDB Description: Crystal structure of far-red fluorescent protein Katushka crystallized at pH 8.5
PDB Compounds: (A:) Red fluorescent protein eqFP578

SCOPe Domain Sequences for d3pj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pj7a_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elisenmhmklymegtvndhhfkctsegegkpyegtqtmkikvveggplpfafdilatsf
mygsktfinhtqgipdffkqsfpegftwerittyedggvltatqdtslqngcliynvkin
gvnfpsngpvmqkktlgweastemlypadsglrghsqmalklvgggylhcslkttyrskk
paknlkmpgfyfvdrklerikeadketyveqhemavarycdlpsk

SCOPe Domain Coordinates for d3pj7a_:

Click to download the PDB-style file with coordinates for d3pj7a_.
(The format of our PDB-style files is described here.)

Timeline for d3pj7a_: